LL-37 Peptide Specifications – Purity, Identity & Documentation Guide
Understanding LL-37 peptide specifications is essential when comparing research products.
A product listing may include a peptide name, quantity, purity percentage, and price, but these specifications answer different questions.
Researchers should evaluate them individually before making a procurement decision.
What Is LL-37?
LL-37 is a 37-amino-acid human cathelicidin-derived peptide.
The sequence is:
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
It is derived from the human cathelicidin precursor hCAP18.
Accurate compound identity should be the first specification evaluated.
Specification 1: Product Identity
The product should clearly correspond to:
LL-37
Researchers shouldn’t identify a peptide only by broad descriptions such as:
“immune research peptide”
or
“host-defense peptide.”
Those descriptions provide research context but don’t replace molecular identity.
Specification 2: Sequence
The LL-37 sequence provides an important molecular reference.
Researchers should ensure that sequence information, where provided, corresponds to the intended 37-residue peptide.
Specification 3: Quantity
The listed quantity tells researchers how much material is supplied.
A 5mg product can be reviewed here:
https://peptideslabus.com/products/ll-37-5mg-research-peptide
The 5mg quantity shouldn’t be confused with purity or concentration.
Specification 4: Purity
A purity percentage may provide useful analytical information.
Researchers should determine:
- What percentage is reported?
- Which analytical method produced it?
- Which batch was tested?
- Is supporting data available?
Specification 5: HPLC
High-performance liquid chromatography is commonly used for peptide analysis.
HPLC can provide information regarding chromatographic purity.
Researchers should review the result in the context of the method and sample.
Specification 6: Identity Testing
Purity doesn’t automatically establish complete molecular identity.
Researchers should examine available analytical information intended to support the identity of LL-37.
Specification 7: Certificate of Analysis
A COA can summarize product and analytical information.
Depending on the document, it may include:
- Compound
- Batch
- Purity
- Analytical methods
- Test results
- Other specifications
Researchers should review what the COA actually reports.
Specification 8: Batch or Lot
A batch identifier can help connect the research product with its analytical documentation.
This improves traceability.
Researchers should avoid assuming that a test result from one batch automatically applies to another.
Specification 9: Price
Current pricing should be verified using live product pages.
Browse LL-37:
https://peptideslabus.com/products?q=LL-37
Price should be compared with product specifications rather than considered alone.
Specification 10: Availability
Product availability can change.
Researchers should check the current catalog immediately before procurement.
Additional LL-37 Listings
Researchers can also review:
https://peptideslabus.com/products/crown-ll-37-research-peptide
and:
https://peptideslabus.com/products/peptides-lab-ll37
Each listing should be evaluated according to its current specifications and documentation.
Purity Isn’t Quantity
This distinction is important.
5mg describes listed quantity.
A purity percentage describes an analytical result.
They aren’t interchangeable specifications.
Purity Isn’t Identity
Likewise:
purity
and
molecular identity
aren’t the same analytical question.
Researchers should evaluate both.
LL-37 vs hCAP18
hCAP18 is the human cathelicidin precursor.
LL-37 is the mature 37-residue peptide derived from it.
This distinction matters when reading research literature and evaluating product identity.
Research Context Isn’t a Product Specification
LL-37 has been investigated in areas including:
- Innate immunity
- Host-defense biology
- Microbial interactions
- Inflammatory signaling
- Cytokine pathways
- Epithelial models
- Cellular responses
These describe research contexts.
They don’t establish commercial product purity, identity, or quality.
LL-37 Specification Checklist
Before ordering, verify:
Compound: LL-37
Sequence: Correct 37-residue peptide
Quantity: Listed amount
Purity: Reported analytical result
HPLC: Available chromatographic information
Identity testing: Supporting molecular information
COA: Relevant certificate
Batch: Applicable lot information
Price: Current live price
Availability: Current listing status
Browse LL-37 Products
https://peptideslabus.com/products?q=LL-37
Researchers should evaluate LL-37 through a complete specification profile rather than relying on a single purity percentage or product label.
For laboratory research purposes only.
